SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|70682|MicpuC2.PierreAnnot2.00052 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuC3|70682|MicpuC2.PierreAnnot2.00052
Domain Number 1 Region: 104-500
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.62e-103
Family Pyridoxal-dependent decarboxylase 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|MicpuC3|70682|MicpuC2.PierreAnnot2.00052
Domain Number - Region: 16-69
Classification Level Classification E-value
Superfamily SIS domain 0.00519
Family mono-SIS domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|70682|MicpuC2.PierreAnnot2.00052
Sequence length 561
Sequence
MTTAYSAMMTPGMESALEPALKLLADHLIALDKRLHDARPSYVVIGAGVSATVAIQAFYY
LLDLRKRCRTKGALWLFFESVKALPIVKGLIAAERGKMIAEMDADMSKKLAKEPPRLTSL
PAKGMSVDAVLVEAAQRKRKDLEWTPTGSLMSGAVYMADDAHFKMLSSVYSSFAHSNPLH
GDAFPAVVRMENEVVNMTATMLGCSPGGPNPNVCGLMTSGGTESILTAIRATRDYSRDVR
GIKAPEMIVAISAHAAVYKAADYFGIELVRVGVDENFRMDINAVRRAVNGNTILIYASTP
GYPHGAVDDIQALAAIAKRRKCCLHVDACLGGFVLPFASSIKPFDFRVDGVTSMSVDTHK
YGLAQKGSSVVLYNSAALRQYQYTAVMDWSGGLYISPSQAGSRSGGLIAQTWAALMRMGR
EGYQRVADDVIAGANELRAGLSEIDGLKVLGEDVSMVVAWGSSDPSLNIYTVNDVMVKKG
WHLSVLQAPPALHMCLTSANVASVRQLCVDLAIAVKETRALGKGKVDGGKAPIYGLAGGL
PDRGTVGDILKDVQDLMLKHV
Download sequence
Identical sequences C1MXR5
XP_003060737.1.6386 jgi|MicpuC3|70682|MicpuC2.PierreAnnot2.00052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]