SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00017734001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00017734001
Domain Number 1 Region: 407-504
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000536
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0091
Further Details:      
 
Domain Number 2 Region: 24-145
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000592
Family PLC-like (P variant) 0.087
Further Details:      
 
Domain Number 3 Region: 161-279
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000639
Family PLC-like (P variant) 0.075
Further Details:      
 
Domain Number 4 Region: 480-589
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000302
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Domain Number 5 Region: 342-405
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000196
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00017734001
Sequence length 590
Comment gene=GSPATG00017734001
Sequence
MGCGSSAGAVIEQNRAPGFKGPVFLTIKHALLERDVRFIGVMDPYVKLIMGRQEFKTPVA
KEGGKHPKWEGCTHTFQKLLGEQDVIIGQVWCENTITSDILIGEGAFSLTSIRQGNNEPK
RISFLLFHNGEKAGEISLEATFTLDPTGKDLPEIKAPDTEGKFIVKPKFGRLKKNTNLLL
KMDPFLTIHFGNETMNTSVDAAGHTTPKWNDEIIFTRETDEDTLYIEVWAESLIGWNDFL
GCGYASITDSLSLKENQLQTVTIFYDGSNVGEVEVQCTFKTSKPQDYLQKEQKSTEAPTK
ESFQQQLQQYQQPQQQQQQQQQQQQQVLPQQLNQFVQNYEVRYQNSYAQQPMNGRVDFTY
PNGDQYSGDMMNNFKHGQGRLQFSYGGYYEGYWANDQYNGMGVLVIGDSRYEGQFINGKK
NGQGKQVWNNRQQYDGQWVDNNMHGNGEWTFVNGGKKKGVWAHGNRLRWLDDDQNIISSN
KTMVSGFMLTSPNQQFTLSFFHDGRLFIFHNQTRQPIFSAINFNRQPIPPVWLKFDQSGG
ELQMIDAKGMPYWVTGQNFGNYAPPFVLILQDDGRLVIQDANGQPKWYSH
Download sequence
Identical sequences A0DK38
XP_001450802.1.48737 GSPATP00017734001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]