SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00022007001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00022007001
Domain Number 1 Region: 407-466,494-505
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000235
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0091
Further Details:      
 
Domain Number 2 Region: 476-588
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000012
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Domain Number 3 Region: 161-280
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000234
Family PLC-like (P variant) 0.081
Further Details:      
 
Domain Number 4 Region: 29-145
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000234
Family Synaptotagmin-like (S variant) 0.067
Further Details:      
 
Domain Number 5 Region: 342-406
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000471
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSPATP00022007001
Sequence length 589
Comment gene=GSPATG00022007001
Sequence
MGCGSSAGTVVEQNRAPGFKGPVFMTIKHALLERDVRFIGVMDPYIKLIMGRQEFKTPVA
KEGGKHPKWEGCTHTFQKLLGEQDVIIGQVWCENTITSDILIGEGAFSLTSLRKGNAEPK
RISFLLFHHGEKAGEITLEATFTLDPSGKDLPEIKAPDTEGKFIVKPKFGRLKKNTNLLL
KMDPFLTVHFGNETMNTSVDAAGHTTPKWTDEIIFTRETNEDTLYIEVWAESLIGWNDFL
GCGYASITDSLALKENQLQTVTLFYDGANVGEVEIECTFKTSKPQDYLQKDKQSAEAPSK
ESFQQQLQTQYQQPQQQQQPQQQQQQVFPQQLNQFVQNYEVRYQNNYGMQPMNGRVDFTY
PNGDHYTGDMMNNLKHGQGRLQFSYGGYYEGQWANDQYNGTGVLVVGDSRFEGQFINGKK
NGQGKQVWNNRQQYDGQWIDNNMHGNGEWTFVNGAKKKGVWAHGNRLRWLDDDQNIIQAG
KTMTSGFMLTSPNQQFTLSFFHDGRLYIFHNQTRQPIFSAINFNRQPIPPVWLKFDPSGE
LQMIDAKGVPYWVSGQNFGNFAPPFVLVLQDDGRLVIQDANGQPKWYSH
Download sequence
Identical sequences A0E0M2
GSPATP00022007001 XP_001456236.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]