SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00003638001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00003638001
Domain Number 1 Region: 3-91,125-256
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 4.32e-38
Family Tubulin, GTPase domain 0.00023
Further Details:      
 
Domain Number 2 Region: 279-473
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 7.63e-28
Family Tubulin, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSPATP00003638001
Sequence length 476
Comment gene=GSPATG00003638001
Sequence
MGTLLLNLGQCGNQLALQMFNLIDKSSMHEGNMFLRRRESNIYHTILVDTEPKILKPIVE
DRKLYSHIDVKNVLYYQYGRGNNWGLGYLNFKQKSKLSKSNQQQAISVFKSSTNEVSIQQ
YCQENEQIVEQIINQARKEIEKTDYFLSISTIMSLAGGTGSGLGSRVIQEFSDIFQEVHQ
NVIAIFPNKTGETPLQHYNTLLSSAHIQQYADSIIYFENDRIYQMLSQIGSKQIDKSVDL
SNVNEYIGSCLMNLFWINDNSTNVRYYQDLLSECCITEGHKFIEVVSAPFTLFSHSNLGP
LCTWEDLIKSSLEQYAFEKFEDDSDQQQQIGEAVAKSLQIQSVQKKGETTLNLQSVFRSE
NVLKTLQDSDSHMKFLERKINSVFNPVQWNPDAVQLHFINEKSSVKGHDQKMNVTLINST
KIIPILKNVSKIAYQKYRSGAYLHWYWKYGLENQDFDNAFESLQKIQDDYNYMVEY
Download sequence
Identical sequences Q9N9D7
XP_001458171.1.48737 GSPATP00003638001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]