SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00008855001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00008855001
Domain Number 1 Region: 393-508
Classification Level Classification E-value
Superfamily PH domain-like 0.00000584
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  GSPATP00008855001
Domain Number - Region: 111-168
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0262
Family PspA lactotransferrin-binding region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00008855001
Sequence length 522
Comment gene=GSPATG00008855001
Sequence
MLNSKKLIKQNQLTELNNFLLQVKQAFITDDFEFANEPEKIIDNKFPLQEIIENTIPQIK
QDQIKQATLQPQDDIQNLLSGLTTLLEKNLQESHNLYQIFQSNKQFNSKCQDSNSSFQYQ
KEENIEALQEDIKLNEIKLLQMQNSRLLNKIESLNEQIAQFESDLHENSKDYRQLVSLIN
STYCIQRIQYMVQQNTITILGKGNDEEIEQGVFVIVDDQIILSPSYLDENKMILDISQIL
DVTYKNDFQIIIHYNEGKLILIMENQQDFAKIDLSLWSTMRRNACLNSDKLFENSLFERP
FRQEINIDFKKLKEQLFNIIPQMEQESKQQQQQQQYQQQQQQQFTLNIKGSDHFTEVHQS
SNIQVQSQQSPELKGTQPKQLIQVNQQTKLQHALLQLKQGFCMIKYSEGQRKPNIKIIYL
TENEQYIKWKDELQPFDQKNTSEQKSIQISQIKEVKDKAQGSGFEKFKKYRQGKESLGIT
IIAKRNLELDAPKQEIKDLFLDCLKILLDNKQNNKFELKSKK
Download sequence
Identical sequences A0CNP6
GSPATP00008855001 XP_001439810.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]