SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00009673001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00009673001
Domain Number 1 Region: 437-544
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000135
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  GSPATP00009673001
Domain Number - Region: 159-221
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0141
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.044
Further Details:      
 
Domain Number - Region: 44-103
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 401-443
Classification Level Classification E-value
Superfamily YktB/PF0168-like 0.0471
Family PF0168-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00009673001
Sequence length 553
Comment gene=GSPATG00009673001
Sequence
MSILFEEQLLSHNKEIEMSMKILLQLEEYTEQENIMQIGRLLLSQSQLIKEQQAALSDVE
TLCKDLQEQIDSLCIHKQQLIIENHKYSSQIYELQNNYNSIQKELDSEKYHSQHLSQLES
HINTLQLEQDSLNNHNAWLIQENKRLNENNQQLLKIIDDHEALIQRMSNDQKQLDCLKQE
VQNQIHANKIIAQSHDILVEQLKQKIVEYELKLDFLQQQQQSTLQSRMSFSLVEDLVNQE
DLYQKVNETIQSEFQSIIQNTDNTETNNTEQVDEFTYFKKEYCGLKDNRYIKEIIKKDRE
NMKKDYIFCFSDFIFRINIRGEKSKRIMFITESTFYFFEEHNQNIKITRQFPISKVQQLI
CCEFNPILCCLKIKGQNDDYLIETFKLKDFIEFLNETLNSQIQISYQQNFLIQFKNYTHP
KNLNEIGNGLYDGSGKQAAFKVSQKQGFLQMQQKTLFGFQDWVEVFALMTDVGLLLFKQA
GDMHPILFVPCADAIIIKNPLKCKPNCLKIKYRDCEYVFNVTSQALLEEWFQELNRQVVS
QHKLQLSQSLRNL
Download sequence
Identical sequences A0CRE1
XP_001440755.1.48737 GSPATP00009673001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]