SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00009881001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00009881001
Domain Number 1 Region: 204-289
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000131
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 20-130
Classification Level Classification E-value
Superfamily PH domain-like 0.00000615
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00009881001
Sequence length 417
Comment gene=GSPATG00009881001
Sequence
MTDILKNPKVRQIIQDVVGGCANQTATVLEMTFVQIYTADEGKHKFHGSNIAGILCFLID
RREGKCFYLRVYDPATLQVLFSMELCYGIKDFWQPVHGIANFYSIPISKGFIGFLFPNVD
EATKITQKICSNGPTKQQLEEINAQIEKEEKERKKLDKLEKEKGTVKGAFKDFFGLNKQV
EKQVQVSGPTGFKRNQLTFNLDTGEINLDELPPELINAFKKAGITKKDLQDKNQAKEIFK
AVANFNENPTAPPPPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPP
KGVPPPPRGPPPPPPPKAPISGQPQVTQPNTQQQQQAPKQQPKSQSNKNDLLAEIQQGVK
LKHVEKNECKVDIKEMDKKQQDDLSSYLAQMMAQRREQLTKNRKDSSDSHNSGWSDD
Download sequence
Identical sequences A0CS42
XP_001441006.1.48737 GSPATP00009881001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]