SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00033186001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00033186001
Domain Number 1 Region: 243-356
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000135
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSPATP00033186001
Sequence length 359
Comment gene=GSPATG00033186001
Sequence
MQVQSQQNSRQSRKRIFDSPISESVSLSRNQSTNFTPVQFDENERILIKTSQFFTITPVD
QSIQEAQFQQPIQAEIAFTIQNTPQFFKQNKFIRRELGKYINESGQLKIDEGQSEDMQSS
EESLNSFPQKFISKFEKNDSIKQQSLVTNHQNQQDYSLKISDLKSEQILKDIQIQENQLD
SNNNSQRMTQVIFSIQKSQIDQQSAKSIESVKNENQDSIISNAQLSQQFNQQQSFDQSNI
SQWSVEQIEILIQGIQVTKYSRKTLFGKKRRILQVSPDLKLLIFRNLEHKITKTYSINKI
TKIEKGANTETFRLYKPKSDILWLCFSIFLDERTVDLSVKTQEQLRQILDCLYGLIQKN
Download sequence
Identical sequences A0BXR6
GSPATP00033186001 XP_001430731.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]