SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSPATP00038073001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00038073001
Domain Number 1 Region: 2-220,248-274
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.35e-70
Family Tubulin, GTPase domain 0.00000828
Further Details:      
 
Domain Number 2 Region: 276-456
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 1.53e-53
Family Tubulin, C-terminal domain 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00038073001
Sequence length 469
Comment gene=GSPATG00038073001
Sequence
MPRELIFVQVGQCGNQIGMRFWDLALKEHAKAKQSLLYDESLSSFFRNVNSKNQELKIGD
PIQNLKARALIVDMEEGVINQIMKSPLGELFEERQCINDVSGAGNNWAHGFYHYGNQYEK
HIEERLRKTVEQCDSLQCFFMTHSIGGGTGSGLGSRIVGLLEDNYPEVFRFTASVFPSGD
DDVVTSPYNSLFSLYELAKHADCVFPIDNQALINIVDQIDKPNKARLVKENAHEGSVGIK
ITQFGEEEKRQKPFDKMNSLIAHLLSHITCSMRFEGALNVDLNEITMNLVPYPDLHFLIS
SMAPLYSLLDSKLQPRRLDQMFNDIYHPDFQMITGQPSLHKYLAVGLLVRGDVAFSDVNR
NIKKLKDQLKMIYWNQEGFKYGICNQPPIGQQYSMLCLANNTCIKDTFQEMTDRFQKLYK
RKVYVHHYKQYMEQSHFDETLNGIQNLMVKYQDLEMAQPKKYQRIQPIF
Download sequence
Identical sequences Q8WPW7
GSPATP00038073001 XP_001437029.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]