SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000007291 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000007291
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-54
Family Nitrogenase iron protein-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000007291   Gene: ENSCING00000003546   Transcript: ENSCINT00000007291
Sequence length 262
Comment pep:known scaffold:KH:HT000133.1:104530:106419:1 gene:ENSCING00000003546 transcript:ENSCINT00000007291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSSLSSVKNVILVLSGKGGVGKSTLSVQLSLGLVHAGKKVGILDTDICGPSIPRMLNL
ENASVFQCDQGWVPVFATEDEKLCVMSIAFMLNGKDDPVIWRGPKKTAMIKQFITDVHWG
DLDYLIIDTPPGTSDEHLSVVQNSKGKVKGAILVTTPQAVAVSDVRRELTFCRKTSIPII
GVVENMCGFVCPHCSECSLVFSQGGGEALAKQEGLDFLARIPLDPDLAKCCEDGKKMINV
FPDSKTLNSINQLVDKMLDNPN
Download sequence
Identical sequences K9J6P5
ENSCINP00000007291 ENSCINP00000007291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]