SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000011997 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000011997
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.67e-32
Family Transducin (alpha subunit), insertion domain 0.0000577
Further Details:      
 
Domain Number 2 Region: 126-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000186
Family G proteins 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000011997   Gene: ENSCING00000022191   Transcript: ENSCINT00000011997
Sequence length 168
Comment pep:novel scaffold:KH:HT000758.1:406:4447:1 gene:ENSCING00000022191 transcript:ENSCINT00000011997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKKFIYINISANREKRNKIVDIKKNMRDAMVAIMMAMGDLEPPVLVDKESNAARREYILH
EAIYYKEEEDFDESFFDTIEELWSDAGVQKCFDRSNEYQLIDCAKYFLDQIKTIRLKDYS
PTDQDLLRCRVLTRGIFETKFSVEKVNFHMFDVGGQREERRKWIQCFN
Download sequence
Identical sequences F6RFS0
ENSCINP00000011997 ENSCINP00000011997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]