SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000014736 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000014736
Domain Number 1 Region: 2-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-66
Family PAPS sulfotransferase 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000014736   Gene: ENSCING00000007185   Transcript: ENSCINT00000014736
Sequence length 259
Comment pep:known chromosome:KH:7:3614827:3617712:1 gene:ENSCING00000007185 transcript:ENSCINT00000014736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWKNDVIIAAYAKTGTTWVRNIVSHLIYRQNPQAMEMYKNLHAFLVYLETGTLLDKLPW
KRRILATHIPAKLLNMKRIKGSGAKIICPIRNPKDQIVSWYNMAKKLPVPKNHELVKSLY
PRTWEEFIEVYTQGQQPLASKVGEWYPDYLLSWYQHKEDENVLFVVYEDMKKDPVKEIQK
IADFLDIPISESDLDEVVHETSFNTMRRQSAQIEKKLDFYRKGEVGDWKNHLTVAQSEMI
DAKIQEKLGHTDLKFTYEP
Download sequence
Identical sequences F6ZAA5
ENSCINP00000014736 ENSCINP00000014736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]