SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000015589 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000015589
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.42e-38
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000015589   Gene: ENSCING00000007599   Transcript: ENSCINT00000015589
Sequence length 228
Comment pep:known scaffold:KH:HT000122.1:170151:171298:1 gene:ENSCING00000007599 transcript:ENSCINT00000015589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVGLTGGIASGKSTVSKYLVELGCSVVDADLVAREVMLPGETAFRRTVETFGREVVDG
NGEINREALGEIIFRDAEARKKLNKITHPQIIKKMLLKILMSFLKGDRFVVLDVPLLVES
KIWVRFVRHLVVVNCSPGAQLERLMKRNDYTEEEARIRITSQTPLSEKCKLATRIINNDG
SIENTRCQVREFVEDLKKSWSFNFYEVCGLSFVCCIMLKIVFSKKYLV
Download sequence
Identical sequences F6ZJW7
ENSCINP00000015589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]