SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000017659 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000017659
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.26e-31
Family Pentapeptide repeats 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000017659   Gene: ENSCING00000008646   Transcript: ENSCINT00000017659
Sequence length 191
Comment pep:known chromosome:KH:2:4133583:4135480:1 gene:ENSCING00000008646 transcript:ENSCINT00000017659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METTKVMFQVVVLMFAVVSQVSTADYSGEDRRGQSFLGVDHSFSKFVGADLRGSNFIGAN
FSFSDFGGSDFRGCDFNGCIFSVSDFGGALFSGSHFRGSDFSFSDFSGSDFSGSEFTGSD
FTHSKYNGADFTGSSFRGSTFASSAFNSSDFSGSEFLGSSFATSEFIDGDFSGSTFVNSE
FTGKNFVKERP
Download sequence
Identical sequences F6ZYT4
XP_002123229.1.78797 ENSCINP00000017659 7719.ENSCINP00000017659 7719.ENSCINP00000028807 ENSCINP00000017659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]