SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000018700 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000018700
Domain Number 1 Region: 253-306
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000117
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 187-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000222
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000018700   Gene: ENSCING00000009197   Transcript: ENSCINT00000018700
Sequence length 325
Comment pep:known scaffold:KH:HT001131.1:11584:14812:1 gene:ENSCING00000009197 transcript:ENSCINT00000018700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEPSAGGENVGFKKAAGFKRGGGRKRPQRRVVEKNNSSSSSEEESAVVRKEKRQILNH
MKQSTNKMKKKVKYSSSSSSESDQKAKAIAVLYKSTQSAKASGPDDMGATKIFELDTSKD
RDAQAVFERAQKLQEELKSGEADDKVYRGAAGYRKFIKPKDTALGNASSGMVRKGPIRAP
EHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELTEGTYGRNQE
ENWEVSDSDDELPFKCFICRKSFVDPISTRCKHYFCEQCALNHYRKSRRCFVCGEQTNGV
FNPAKEIVSKMENESKQSQIVEDGD
Download sequence
Identical sequences Q67EQ6
ENSCINP00000018700 NP_001027830.1.78797 ENSCINP00000018700 7719.ENSCINP00000018700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]