SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000028994 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000028994
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.32e-50
Family G proteins 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000028994   Gene: ENSCING00000016915   Transcript: ENSCINT00000029240
Sequence length 200
Comment pep:known scaffold:KH:HT001236.1:16118:18914:-1 gene:ENSCING00000016915 transcript:ENSCINT00000029240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQKMRHFKIVLMGAGGVGKTSMTTQFVTEHFDENYEPTIEEIHRKTITLDGEQCMLELID
TAGMDQFSQMRDLYIRKGDGFILVYSIIDPTTFEDVKSIREQIVRNKLSEQVPIVLVGNK
RDLAEHERAVEEEEGSTLAKRWSHCRFIETSAREHHEVGEVFAQVVRQILDYENARKARV
NTLHNEASRRKRSSGKCSIM
Download sequence
Identical sequences F6Q349
ENSCINP00000028994 ENSCINP00000028994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]