SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000032057 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000032057
Domain Number 1 Region: 42-143
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000262
Family Pentapeptide repeats 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000032057   Gene: ENSCING00000024628   Transcript: ENSCINT00000030447
Sequence length 147
Comment pep:novel scaffold:KH:HT000185.1:96623:97297:-1 gene:ENSCING00000024628 transcript:ENSCINT00000030447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGCTFSKHLFIGVSFIIWCDIIAGDIIMNDVISKCFFSFNFDIIRCYIIRCDIISSDI
IRCDIISSDIIRCDIISSDIIRCHIISGYIIRCDIIRCHIISSDIISSDIISSDIIRCDI
MSFDIISSDIIRCDIISSDIIRCDIIR
Download sequence
Identical sequences H2XQX3
ENSCINP00000032057 ENSCINP00000032057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]