SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000033701 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000033701
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-37
Family G proteins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000033701   Gene: ENSCING00000016523   Transcript: ENSCINT00000030609
Sequence length 223
Comment pep:novel scaffold:KH:HT000098.1:677500:679816:1 gene:ENSCING00000016523 transcript:ENSCINT00000030609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHIMTRLLQKRRETVLMLGLKNSGKTTILYKLLTGKKILSVPTFGFNMEILPFNDIELD
VMDVGGGEKMVPLWKHYLITAAAIVYVLDCNDWGRMNENKELIEDILSRPERKGVPLLVI
VNKAENMTRPMTSGHFQEKLDLNSNTRGRKYKVQFVSAETGTGVVEAFTWLCAVLGSGHA
SRKIKRLREKEKKKGAQTVSKINPSEQKVEDSNSVELGQSTAC
Download sequence
Identical sequences H2XVL7
ENSCINP00000028575 ENSCINP00000033701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]