SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000033812 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000033812
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-49
Family G proteins 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000033812   Gene: ENSCING00000023768   Transcript: ENSCINT00000035012
Sequence length 215
Comment pep:novel chromosome:KH:6:1971681:1980808:1 gene:ENSCING00000023768 transcript:ENSCINT00000035012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNLSAKVLVLGDQGVGKTSLVMRYSRKIFVETSTPTIGAAYFEAIEEVGDQKLKLKIWD
TAGQERFKSMIPMYYRNSKAALIVFDITDSDSFVAAQKWATELHQHIEDKLILFLIGNKS
DLGRSRKVKQSEANAYAEMIGGHFREVSAYSNEGISEMFLDLCVKLLHEKLNSRRNTIGQ
VTTWPTNDSLVSSQYPPIEFKENEAEKNTCCFTFT
Download sequence
Identical sequences H2XVX8
ENSCINP00000033812 XP_009858857.2.78797 ENSCINP00000033812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]