SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000002828 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000002828
Domain Number 1 Region: 293-356
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000592
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 29-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000127
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000002828
Domain Number - Region: 186-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00011
Family C1 set domains (antibody constant domain-like) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000002828   Gene: ENSCING00000001444   Transcript: ENSCINT00000002828
Sequence length 397
Comment pep:known scaffold:KH:HT000092.1:7631:17195:-1 gene:ENSCING00000001444 transcript:ENSCINT00000002828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSAAIFFMVLIGGTQCLRVSYTGPPRFPMNSDAVLSCQVDPPPSVPEDGDNLAVWWSL
VTSGGSRIKLGKSSVADSYHYNNFPNDLKDRFFMSTDNFGVGRADATIQSIRIVDGAQYQ
CEVENLTSHDADNVLFEVNVYNPPNVEINAMEINLDIRPIIQEEPTESSTENPMYDGTPA
ISEDPVEDTQTNVTIAQCVATFAYPRPQKFEFISEGTANVWTVVDGSDVKYETNDDGTYN
VSAILRIDPTAELDGDTIFCKTWLYPDLEFGSTGTTPHIVVKHVTSEASIYIRNSVVEEG
DSVTISCSANGNPAPMLELQDPSGNYHNVTGEDFIISRATMNDRGLYTCYAYTDDSTEPK
AQDSASLDVKWIEAPQITSNGAVVSGQPVVVEVWWKS
Download sequence
Identical sequences F6W7B4
XP_002129785.1.78797 ENSCINP00000002828 ENSCINP00000002828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]