SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000006610 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000006610
Domain Number 1 Region: 187-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 4.18e-77
Family Mitochondrial carrier 0.0000696
Further Details:      
 
Domain Number 2 Region: 14-162
Classification Level Classification E-value
Superfamily EF-hand 2.95e-34
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000006610   Gene: ENSCING00000003221   Transcript: ENSCINT00000006610
Sequence length 476
Comment pep:novel chromosome:KH:9:1761550:1767511:-1 gene:ENSCING00000003221 transcript:ENSCINT00000006610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNDGSPQSICPQKEAYYREIFDRLDVDNDGRVDVHELKEAYMKMGLLQVPGQAEKFVSA
SDSNKDGELDVAEFVRYLHEHEMKLKLMFKRLDRDKDGRLTSAEIEEALRSVGFDVSKDE
AKEITRRIDKDGTSSIDINEWVEHHLLHPSADLKDIVSYWKHATYIDIGESLIVPDDFSE
AEKVSGQWWRQLVAGGAAGVVSRTCTAPLDRLKVLMQVHATKSNQLGISSGFNSMLKEGG
AKSLWRGNGINVIKIAPETAVKFYAYERMKKLIGAQSGGEIGAAEKFLAGSMAGVISQTS
IYPMEVIKTRLALRKTGQYSGIFDCAFKVLRNEGPKAFFKGYIPNCLGIIPYAGIDLCIY
ETLKNYWIKTYGAEKEKPSVLLLLACGTTSSTCGQLASYPLALVRTKMQAQALASLPNHD
KNQKTSMVSLFRSIVQTDGVFGLYRGLAPNFMKVAPAVSISYVVYEKMRMHLGVYR
Download sequence
Identical sequences F6ZP71
ENSCINP00000006610 ENSCINP00000006610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]