SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000007492 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000007492
Domain Number 1 Region: 107-292
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-52
Family Nuclear receptor ligand-binding domain 0.00000778
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000007492
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000153
Family Nuclear receptor 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000007492   Gene: ENSCING00000003634   Transcript: ENSCINT00000007492
Sequence length 294
Comment pep:known chromosome:KH:2:5033793:5040135:-1 gene:ENSCING00000003634 transcript:ENSCINT00000007492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMYTRRKCPECRLRKCRAVGMLEECLLTEIQCKSKRRSRKVKTIQEDDETKESVPNPIP
PPKPAVKSPPEPDETDLLIELVGKSFSDYRNNPEIVNRWECFYELSTKTPPNLCEIATIH
VQVLVEFTKKLPGFMRLDSHDQIALLKGCVVQAMLLRNSCGYNKVNRFLDLKRVVRDTGI
KEDHIRTLTDFFDNVAKLQMDETEYGLLIAIIVFDSDHTDLENRLTIDKYRDRYLSALSR
YSEAREPRRPQIFAKILSLLTEMRTLYHTHAKMVLDWKQREQLTPLLCEIWDMR
Download sequence
Identical sequences Q4H3G2
ENSCINP00000007492 ENSCINP00000007492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]