SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000016461 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000016461
Domain Number 1 Region: 173-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-96
Family Protein kinases, catalytic subunit 0.000000000585
Further Details:      
 
Domain Number 2 Region: 13-128
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-22
Family Pleckstrin-homology domain (PH domain) 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000016461   Gene: ENSCING00000008043   Transcript: ENSCINT00000016461
Sequence length 512
Comment pep:known chromosome:KH:4:1069131:1079849:-1 gene:ENSCING00000008043 transcript:ENSCINT00000016461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTTTGPSMASIVKEGWLQKRGEYIRNWRRRYFVLKTDGSFLGYKDKPDPDNHQEPLNN
FSVLKSQVMRKDQQRENAFVFVVRCLQWTTIIERTFTSTSKVDREEWMKAIEGVSDQLQH
SPEEKSVTEDESKKTSDHKVINTVCENTFNKHANPLIKQPENEFIKPAKSNKTLTDFEFL
EVLGKGTFGKVILVKEKKTEEFHAMKILKKEVIVAKDEVTHTLTENRVLQQTRHPFLTSL
KYSFQTNDYLCFVMEYVNGGEIFFHLSRDRVFSEDRARFYGAEIILALDYLHQQEVIYRD
LKLENLLLDSEGHIKITDFGLCKEEIRFGTTTKTFCGTPEYLAPEVLEDNDYGRSVDWWG
LGVVMYEMMCGRLPFYNRDHDVLFELILMDDLRFPSGLSKEGKSLLSELLNKDPLKRLGS
SQSDAQEVMAHRFFSAVVWKDILEKKVPPPFKPQVSSITDTRYFDKEFTAQPVQLTPPDQ
SSSMDDTNRPHFEAFSYSSSGSHLDKGSRNHR
Download sequence
Identical sequences F6S4F7
ENSCINP00000016461 ENSCINP00000016461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]