SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000022112 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000022112
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.66e-19
Family Hormone receptor domain 0.0025
Further Details:      
 
Domain Number 2 Region: 94-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000357
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000022112   Gene: ENSCING00000006559   Transcript: ENSCINT00000022358
Sequence length 397
Comment pep:known chromosome:KH:2:961640:973508:-1 gene:ENSCING00000006559 transcript:ENSCINT00000022358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYKEQCEKSLNETLKNFENQTFCPGFFDRQICWPHTPAGQLSTEPCPSYIEWRNVIHLQ
ESLVAYRFCEFDGSWMVRNDTGQSVQWVNRIQCDVATNGLQYELGPLEIFDVVIKIYTAG
YIFSLVCMVIALFILMFFKKLHCTRNYIHMNLMLSFIVRYVAVMVKDKVLEDHYAVGQTN
LTQMEMSQYCDDVAGTDGLMVSCRLVITLMHYAIIANYFWLLVEGVYLQLLLVFVMTEYK
YFPIFMAFGWGAPWIPIGIWVAFRITFENVGCWEIYNALRTWWILSAPILISIAINFIIF
INIIRMIVSKLRANNMTRSDYKYRLARSTLALIPLLGIHYIIFMGVSDSVTNSTITKTKF
AFELILTSLQGSIIAILYCFLNGEVQTEIRKCWRNWR
Download sequence
Identical sequences F7AQZ5
ENSCINP00000022112 ENSCINP00000022112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]