SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000022455 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000022455
Domain Number 1 Region: 31-188
Classification Level Classification E-value
Superfamily SIS domain 0.0000000512
Family mono-SIS domain 0.0048
Further Details:      
 
Domain Number 2 Region: 479-524
Classification Level Classification E-value
Superfamily SIS domain 0.0000741
Family mono-SIS domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000022455
Domain Number - Region: 298-370
Classification Level Classification E-value
Superfamily SIS domain 0.000381
Family mono-SIS domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000022455   Gene: ENSCING00000011850   Transcript: ENSCINT00000022701
Sequence length 589
Comment pep:known chromosome:KH:7:5150540:5155724:-1 gene:ENSCING00000011850 transcript:ENSCINT00000022701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASDQHSCGGVNWPLFGNISISDVTMETPYTEAANKITDDIDVCDVAGIFEKLKQCDFEM
FEPKGYGDVKTLFHDDVIEAISKVANIAADIMTSQTPNAIVISGCGTSGRVAFLTARSLN
KIVPGEKFRYTIAGGDKALFTSQEAPEDNRKAGVNDLIKSTIDDVKVLYIGITCGLSAPY
VAGQLDYCMDNLDKFVPVIIGFNPVYLARKNPIYDWDKTFYDVVTRLERLTSQRKGFLIN
PVLGGEAITGSSRMKGGSITMVILQTIFTHALNGVLTSSDMTSQLECKNLLKSYQNTCRL
FYESSTTTVTTLMTSATQSLKSNSSVYYVSSGGSGVLGIVDSTECIPTYGASLDDVRGFI
VGGYGEFNNAEGDIGSLGKNYQIGCDDLSKLLKLRDLEHNDTILVVAKSWDDPVLNEIQV
EKGKKKLKLSASQSNVYVVVIDTEQGKREKNMPDYVAKLFVISIDLNEELLSENLIEICS
KWIFNAVSTGAHVLIGKVFRNYMVDLKVSNQKLFHRSIGIIQRFCPSVSEQEAMTYLLKS
IHDVTNVDDVMHRSIKDHVLRATPKDKVLTTYCLSAVLRCSTSPKQARM
Download sequence
Identical sequences F6Z326
ENSCINP00000022455 ENSCINP00000022455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]