SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000025063 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000025063
Domain Number 1 Region: 816-1059
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000213
Family Extended AAA-ATPase domain 0.041
Further Details:      
 
Domain Number 2 Region: 463-595,637-722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000978
Family Extended AAA-ATPase domain 0.029
Further Details:      
 
Domain Number 3 Region: 2012-2065
Classification Level Classification E-value
Superfamily RING/U-box 0.000000578
Family RING finger domain, C3HC4 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000025063   Gene: ENSCING00000013710   Transcript: ENSCINT00000025309
Sequence length 3105
Comment pep:novel chromosome:KH:1:3619102:3636841:1 gene:ENSCING00000013710 transcript:ENSCINT00000025309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTCDSDKHLQHYITSCFDENQVESKFPSLPIKIEEYVKKHLVVGNEVETASTVDTDHSSV
RVVFAEQAGMGKSLYVARRRSDLEKKFHGEVYWNSTTIRFLEKSVNIDDVVMSLLESEEE
VCNKEPHFVHIDITPSVQSGVQKFLFDLIILGKITSSLGRVWRHHPQHFYVIEYTIPRAR
VSFLQGSISYANILRLLPSVTCLTPMQVKGHLENKTEQRELENLVMIDNELLMSPTYQRP
YQYLYKYSHQEDLDNFVYHQPKNNPLEFLETLLKFCSIEEPSWLELSHFCRFLNTQLNDC
EKSDFCIAEAVGPTLNFDAGLAGFKKFVVRFMIRMSQDFATPSLSDKHQVGNQENDLLEL
HQLRRRWENNLHPYMFFNDDRFSMSFVHFNINNRGDLCHPVTYETIQAGIMTNLLFRGLR
IQGVNLSQNFDLVSREDKLATLCNVFGVKKVIDPDPTYELTTDNVLKMLAIHMRFRCGIP
VVIMGETGCGKTRMVEFMSKLKSGEVSKERKVKNMVVVKVHGGVTVGIIQEKVREAITLA
QKNKEEGNLETVLFLDEANTTEAIYAIKEVVCDGTVHGKSFVDTGLKIVAACNPYKKHSD
EMIAAMEKSGLGFHVKSQDTAETFAGIPLRHLVYRVTSLPPSMLPLVWDFGQLNAETEEI
YINQMVIKLQNDVENMELKDLSENMLAIITKALTRSQSYMREQTDVCSFVSLRDVERTIK
SYKWFYQQLQTLSPLIDEEKKKLYKRANPLPNELRALVLALGMCYHTTLPERQEYREAVT
QSIFQAGGKINAPTMLQEIVACQNVFINEIELEKDIARNEALRENVFMIITCAEMRIPLF
LVGKPGSSKSLAKTTVADAMQGGNSKNPFFQKLKQIQLFSFQCSTVSDAVGIEKLFNQCV
QLQKNQDLDRYVAVVVLDEIGLAEDSPKMPLKVLHPLLEVGSTETVGLEVPPHNQVGFVG
ISNWALDPAKMNRGIFVTRGNPSNDDLFKTAEAIFKSDKEKMGEVNKNVKALTTAYLEIY
KEQKKEFFGLRDYYSLLKMMFAILSDKESLSFKDIGRLVIRNFSGSKQSTWSKQSTWEVF
EKHLSQLYERTYKPRISVEALIQENLNQDNESRFLLLLTKQYSAVSLLSRVMGDVKDFQV
IFGSSFPRDHDYTEVCRNINRIKVCMESGRAVVLLNLRDLYESLYDALNQHYVTFADQRY
IDLGLGGHRVKCRVAKGFKLLVIEEQDIVYNEFPIPLINRLEKHVFDMQSILNIEQQELV
NELLQWVAEFSRISLPIYPRKSFTEPDAFIGYHHNTIATVVLNMEDGEHLRENILLLEQV
KKALLQSASMDAIYRLPKSKSKRDSGALYKIYAEEQQHDNLSAMLQNEIQNKAVDSISVF
EVSSFSQVLNEQDRLRLESHLQLPQNRIMLLTLQQFQTEREYSGRLDEFFKFASTGDANQ
EDSVFILLVQCPQVQQHSNLIACAKYCAMNKVKEIKEQMLEVKSSIIIAFLFTLERQTGI
AGTNKSYTSFHSRDCQSVYVDELRPGRDFIASASKFWELGVLEVLQISAEIMNQNLDQSI
TLYDGPALDLYQLLKESIPQAIAKLQNKEASVTRNRVKILMELLFGNKLVTEGFQKIVMT
HIFYLMQKRKDKLEHDDWAIQEACSPQALQEGGTFRKTLWLKLKSLVAVAMAKVISVTDV
DNNLDSICNDQQDEGFLDLWLEIFQSQFIQKSLSWPEHLSNVNLVICCQKGFACKFPFSR
QIINELLQQWKMVNQLAVDDVDKIDRFFQKVSGSPLKPILAKVTEHDAINNIKLFTSDLV
HILYKMTASEKEYAAVTECMLALLLAKRNAAQHHQNVLLEMFMSFVHSMEELKQLSDILE
VQPQVIDDVERWTEDQSEQQTVVVHISAFQSLVTALENGAPKIDKEWKEKVSKTKHVANK
ILVSPLMQTRHELKESWRRIVFVEMFLDQLIPSATLPETAQRYLATLAPLARRLWTGATK
IKDLTDNRFLNILTKTLQGCAQDINLKLLCSWEKLQCKVCRSDKLSEPVKLPCKHLVCMK
CVPVESPERSCPICRKKISENLELKPIELQNDQKKELKQFEVACQSFFLDYLSTLCFPNP
ELSNQDEFNQPPDEKITMALEKLVICDKTTHDISPIRKSLDPSPTARSFILQLLLRCNPV
SVQNQLDRHFTSMTSVLDKKMIMDIYTQCIQDMQQSRATMENPAEEISATYAAEMFDECK
ELCKYANNFKQVQHLNLCAKLKFISRVVVNCVYHLQSKTDKSKKFKEYRDMVTFVGAVCA
NCQHTKFLVMKQYIIKTLCRRYGMDAFNILIENDGYRKSLVPQNLLPAQDAVEENLYLQS
DLLVLTGDIYIRTKALFLDIAQEEDLPNLFKKIIHEIQQAPDSIFQIMLALAVWTAHGSA
PHQLRKASYQYITGRLQSHLAGKASQYFLSNLAQQKYEFQIKELSPQMAYKVTELVNLIG
AVVLSNNVGVLENLADLVNKPENYTDLFLPTMPASNFFEVRDVLKLERAHNTSPKAYLCP
EGHVYFIGECTNPVQEGKCPECGNKIGGRKYGLLHAGNTAGELTEASQAGYLLKNAAQCQ
LPTQERKLTKLSVCALRACLHSCMLLANKEKGTIQRMVKVKSKEEAQHFLVQHVYNDMRN
LATCLGRSIDDAFIMMHQIVHKILSFQYKMAGNQILSLRSMAARTQWEEAFQRQFFSLAF
QNTDTLINAAQAVIVQVGDFAQRPLEKIVYELNLNGDLEDGVIPWNSPSLWNYRIHADML
NVRQKLEAVDETVGGEGSILKVLLNVEHLDLLRFLCDLLKVQVSYTHSFNHLMFSQYKDI
ANFIEDNESDIEDQIEQYISIWNKLRKDLEKVDRFKMPKSFFESDMNMDSPISMCLPSKH
GRGGCALLLVEYFITMQNTLLLKCRDLITPTPSFPVVDVRMNMENDLICIVESHDLMPLV
IANSQYEYSKDESGTKHNIAYNFGSQVKEKFILRKSLLKIETIPQMVYPQDVGLKNEVEK
VNEKTTQVPLPQRLIQDLDTNLENARTADICEAVRTITLAISFIAKLGGEAEQAICDYVE
KDILLSPEETALIPRTAQICHTIALYERLSWHRSVRFVLNGDNPF
Download sequence
Identical sequences F6PRC5
ENSCINP00000025063 ENSCINP00000025063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]