SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000033372 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000033372
Domain Number 1 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000367
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 2 Region: 111-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 26-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000835
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 4 Region: 150-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000033372   Gene: ENSCING00000022067   Transcript: ENSCINT00000032241
Sequence length 203
Comment pep:known chromosome:KH:4:432989:439415:-1 gene:ENSCING00000022067 transcript:ENSCINT00000032241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSYTPKAWIIFCLAIITIVCVTSMPECKCKRKQFACSVSNKCTCIPVAWKCDGDTDCG
DASDEMDCVIPTCRPSSFQCDNGKCIMAEWKCDGENDCGDDSDEVSCPIQPCDESTEKTC
GSGDCVPKRWWCDGDEDCSDGSDETDCNRRTCGGTEYACTSGECVSSAFNCDGDFDCRDG
SDEECEEPADPDVIPSNSNFTAC
Download sequence
Identical sequences H2XUN8
ENSCINP00000033372 ENSCINP00000033372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]