SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000033873 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000033873
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.15e-70
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000021
Further Details:      
 
Domain Number 2 Region: 183-290
Classification Level Classification E-value
Superfamily E set domains 3.27e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000033873   Gene: ENSCING00000022223   Transcript: ENSCINT00000032184
Sequence length 706
Comment pep:known chromosome:KH:11:3650561:3658026:1 gene:ENSCING00000022223 transcript:ENSCINT00000032184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRIPVLEIVEQPKQRGMRFRYECEGRSAGSIPGKNTNGDRKTWPSCQVLNYSGVAIMRV
SLVSKDDPPRPHPHSLVGRDCNNGVCQINVDPGNQMLGVFPNLGIQCVRRREVSQAIQDR
LNHGVNPFGTMLDGDERSAVDVDLNIVRLCFEAFIPDARGKYTQKLEPVVSDPIYDKKAT
CSSVLKICRVDKTHGSCMGNEEVFLLCDKVQKEDIQVVFYRDNWEALGDFSSVDVHRQVA
IVFRTPPFCNENIQEKVDVQFKLRRPSDMETSKPLVFTYLPVYHEMPQKHKFPTQLLSHP
IRSNNNKNGEIRKFISDRIRKSKEPAQRQMYSPNPNIAAASLNHHGMIRNPSNPTICPTA
QPSTEQFTSTMNPSYQYVKREDHSSTAIFPGDPQWPDSSHSQPPFPSASSLFNDSMVQPG
FGPIQNTTATPFFDANSGKFISEKSTISEVQKSELAMPTALPPADDGQTQRSYFWSDLLK
QEDSIPRLDAEQTRQLLQDNVSMPDTALENISMDSMLEQWMSKKCSIEGPMSINLTDILA
SENLPSTNNGPTQPIENEYQQMSPYPAFSTSNTAPTTSNLLTQSMTFSQTTMPLDATSTG
ILSPNHTPQLFNHQQHPVMSPIHPSSHQPQQNAVNMQRMDMNLPGQQQRFHPQFSEPTPF
GTNSNNNHCIEQTNPGTFALSPTQNDHNVESTIISTFLQNLETVQR
Download sequence
Identical sequences Q4H2V9
ENSCINP00000033873 XP_009860199.1.78797 XP_009860201.1.78797 ENSCINP00000033873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]