SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000034879 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000034879
Domain Number 1 Region: 36-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000458
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 2 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 80-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 119-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000034879   Gene: ENSCING00000020067   Transcript: ENSCINT00000034964
Sequence length 147
Comment pep:novel chromosome:KH:13:843334:845036:1 gene:ENSCING00000020067 transcript:ENSCINT00000034964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEMKCSNTGPCISKSWACDGENDCRDGSDELPSICGNKTCNSDHFMCGNGILCIPNSW
VCDSDNDCGDNSDERNCTNTPCASGEISCTFTQQCVKKSAKCDGKYDCLDQSDELYCHVT
CNKDQFRCEKPPLCIPLSYKCDGVPHC
Download sequence
Identical sequences H2XYZ5
ENSCINP00000034879 ENSCINP00000034879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]