SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000035771 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000035771
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000808
Family APC10-like 0.021
Further Details:      
 
Domain Number 2 Region: 366-386,429-640
Classification Level Classification E-value
Superfamily ARM repeat 0.000000785
Family PBS lyase HEAT-like repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000035771   Gene: ENSCING00000002147   Transcript: ENSCINT00000034593
Sequence length 855
Comment pep:known chromosome:KH:7:1781257:1792188:-1 gene:ENSCING00000002147 transcript:ENSCINT00000034593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKIGYSVVGSTGEAEGYGAKNLEHQNPTIPGWQTPRFCVYPQELIIRMNERTNVKKLQ
LLAHQFMIPSKIEFFVGTNESADSFKRLGYIYLSNNEKTGFKARELKSVHVDADGHFLRL
VVHKNHMNKFNLYNQVGIMAFNVIGDGISKRHPLKPISSGTTNPLNYSIEGSINKPDYIS
PMDDLAFDMYQDPEVAGIIRKLDVKKQKAVIAENFDVAKRMKQAIADLQKVGEKLARYEL
DKRRAVEHEDYDLAKSKKSQMDEYRLKVYQQLQKYNLLEDAGISPVKQNGEQPLQQSPNQ
AHAGPQPSPPPMESPSLFVPHEEIASPRLEPPQEQKTFKTQIQEKVASPEPVATYSPRVR
HSPAIYDEKVIPALVKHKDPDPFLEDEFKNSCFSVAINKPSAPSGEPEAMSEKSIREASS
VIDVFGLPLVSGAYSKTWSFREDALLAVYKLLSNAPETISKDELKSHLRAAIFLIRRAIK
DKVHAVFHASLRLLELILVDFVPKHKLGKVETVHAVSRTLPNLIQKTGETAARSRNAAIE
FIDRMSEFAMVHQYQLVAQQATPPFKRDMAMRLALSRVEILERLFTKFGLEPPVLTVETG
MKFASQALSHSSGSVRDAATRIIFLLYKIAGNAVKAYLPPDDNTTRKNPLYRNIFDGFDR
ISGKLTQSELKAQQQAKAAESERKKKQEIEDLQSQVNQLRQMNNMVANEKSKKSTTKPPP
PPAEGSEASPNKAGDENDSTYLENMCIFCGERDDAFTEEGLDLHYWKHCPLLKKCEHCKQ
VVEVAGYCGHLLTECDKKSEFGECPRCKEAIPLTDLDKHVADKRCTAAKPGLDHCPLCHK
NIALGEESWKSHLMG
Download sequence
Identical sequences H2Y1I7
ENSCINP00000035771 ENSCINP00000004377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]