SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000006033 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000006033
Domain Number 1 Region: 168-352
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.53e-35
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000006033
Domain Number - Region: 76-113
Classification Level Classification E-value
Superfamily WWE domain 0.0745
Family WWE domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000006033   Gene: ENSCING00000002959   Transcript: ENSCINT00000006033
Sequence length 353
Comment pep:known scaffold:KH:HT000103.1:299816:304671:1 gene:ENSCING00000002959 transcript:ENSCINT00000006033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQNLIQTEMESNQISDPCIAHLDADFKNGILSVKQEMVKIKVDTRLGMIKVRGITKFV
KNATIDIQRILGEFSKATAVKELVQWMYCVQGSNSFQAFELRINMQLENSFKVDNNGILK
MPGKDDFFDFSKAEGYFKNSVVEIFRVDKQKSYPRNWRPMKRENWLNVDVPENSDEYRKI
QSEFLKSGALIKAVVRLQRIQNRCQYVQFQAKCQEVKTELDARRINVPPTRLLFHGTSSV
MSDKICKEGFNRSYAGKNGIRYGQGMYFAGNSAYCHDYAKPDDNNFRRMFLAEVATGEYA
PERGNESMITPPVRNPSSKTDSYHSVVDNPQSPEIFVVFKDACAYPHYLLTYI
Download sequence
Identical sequences F6R497
ENSCINP00000006033 ENSCINP00000006033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]