SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000014302 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000014302
Domain Number 1 Region: 655-708
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000155
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000014302
Domain Number - Region: 546-592
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00817
Family Fungal lipases 0.054
Further Details:      
 
Domain Number - Region: 255-323
Classification Level Classification E-value
Superfamily WWE domain 0.0114
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000014302   Gene: ENSCING00000006960   Transcript: ENSCINT00000014302
Sequence length 1009
Comment pep:known chromosome:KH:8:5451915:5461356:-1 gene:ENSCING00000006960 transcript:ENSCINT00000014302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSKGNPPPTNPLFSPMNNINFGTNALFMPVQEQSSAILAPETDPAEEASFLGQSSTSYS
TGGEQQPQNVATFTLFSQKNDNNGTKSDPFANLSSGANSKEPPTFTSQSVFTSEQQQPQL
FVPPSASPDQSINEEFPYSTNSPLVNVTGTLTPGPSLSAPGMLPTPPPNTQSQTPNNPYA
RSASRNRTMFPPNPELYNPSPTPSPQFMPPQMTTPGPPPVQLTQSVSAPTQTQAPTPPLS
FEKLAQSPVPPPPTAENHYQAVVPHWFYCKALTDANNIWCPFSYVDSQYLEKAALDAANG
QGSDIVRTDGGRYDVSVSARERTSLYWDEPPSAVRRCTWFSKSDSDSRFIPYEESLSQNL
EREYHEIVTKGLWHKQIDLGQGEMMVVHNPQLIVHFQPVVPPEHEFGAVREKQLKSKVVK
RGISTTDFARLIPENECGTPDHVVFLCHGIGPVCDLRSRSVVECVDDFRSIHLSLLRSHF
KQGLESKKVHRIEFLPIHWHRALHGDATGVDRNIRRLTLPSISRLRHFTNETLLDILFYS
SPVYCQTIAETIGNEINSLYKLFLSRNPNFTGSVSLSGHSLGSLILFDLLCHQNSPIIPS
NPTPNQPFLPSQTNTTLTEPTDSLGASFNAEATPQLSNSNSMHSLSEKAEEPLTLVQALE
QLNLSNFLNKFEAEEMDMDALLMCSESDIKDIGLPMGPRKKLIGFLKDQKDKETKRKEIE
AKVALESQLLQQTASTMLPNKTLDVPSTPGLEQMESFGSFLSAATNVHVDFQQFDSGTGQ
PAVRYPQLDFQPHSLFAMGSPIGMFLTVRGISELGEDFVFPTCPGFINIFHPFDPVAYRV
EPLINPDVNMKPVLVPHYKGRKRLHLELRDSLGRMGQGLKDGIMKSLKIAIGSMQKFAES
HWQKGQVEHEVEEMTHRLMKEQQDKNDNEDNAILASVTSDIAQLDVGLGRLNGGKRIDYV
LQERPLESFNDYLFAFQSHLCYWNNEDTVLLMMREIYDSMGVKSDSQQV
Download sequence
Identical sequences F6SZE1
ENSCINP00000014302 ENSCINP00000014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]