SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000022462 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000022462
Domain Number 1 Region: 17-68
Classification Level Classification E-value
Superfamily DEATH domain 0.000000365
Family DEATH domain, DD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000022462   Gene: ENSCING00000011855   Transcript: ENSCINT00000022708
Sequence length 183
Comment pep:known chromosome:KH:7:5049796:5053147:-1 gene:ENSCING00000011855 transcript:ENSCINT00000022708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEASCLPSQGAGENERIYADIDRMNNNEWNKFARLESGLGLSNKQIDNIKLQYPTNVEE
QQYHMVVKSRKIREMPRKTEIFHLLVNQFLCPDESNLEKLNKLLQQQPRETIQETIGRQP
TQQGSYQQQQTDSTPFIQMLKNLSNELKFKDFEELKRMYGYCTENRSFGNACELFLFLEN
ENK
Download sequence
Identical sequences F6Z2P3
ENSCINP00000022462 ENSCINP00000022462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]