SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000024896 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000024896
Domain Number 1 Region: 3935-4289
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.09e-125
Family Hect, E3 ligase catalytic domain 0.0000000342
Further Details:      
 
Domain Number 2 Region: 1591-1661
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000445
Family WWE domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1300-1359
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000781
Family UBA domain 0.0098
Further Details:      
 
Domain Number 4 Region: 82-176,255-621,681-701
Classification Level Classification E-value
Superfamily ARM repeat 0.00000101
Family Armadillo repeat 0.042
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000024896
Domain Number - Region: 2980-3047
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.068
Family MgtE N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000024896   Gene: ENSCING00000007623   Transcript: ENSCINT00000025142
Sequence length 4296
Comment pep:known chromosome:KH:4:2111981:2173614:1 gene:ENSCING00000007623 transcript:ENSCINT00000025142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIDRNKLKKCTTEVPADCRVLIDKLKTCSDEELVTILESTTAWTVGKCELYHWVDVLDR
FDGILSAAAYTGESEWLLTVNTDEHLQELALAVLHFTSLLIEYSFSRHLYNSVEHLISLL
SSSNLDMILSVLNLLYVFSKRSNFLSRLADKQRLPLLKRLGYLAENWGGKENGFGLAESC
LDSPVSTFPSNATTLHYEFYADTKTVTESQHTAKKQANNMYCIHVENVHQMSSSPAEIME
SLIKMYPVPNDSKMLLYTHLRLAHSFSQHKTRLKCVQARLHAISVLVYTNSVSENIGSIL
YSGFTEELVDLLQVKDNTLVDIKAAALRTLTSIVHLDCRDRTPRLGAIVDVTGVSQYHGF
LPVLVRRCIDSMTSTKNPEFPHSFATALFSFLYHLSSYESGGEALVQSGMMGPLLSVVTN
MGDQQEQTTFVTRAVRVIDLITNIDWQAFQAINGLQVFIDRLEHEVAICKKDAPMACDTI
PGAAESPSDGKSRTEMETEESGAQCLPQRAALFKSVLNFLKKAISDQAFGGQVRHMMDGT
LPNSLKHIIGNVEYYGPALFLLAMEVVTVYVFQEPSLLSSLQDNRLTHVMLHALLVKDPP
ATREVLASLPNIFSALCINTRGLEAFVNCNPFDRLFHVMLSPDYLLAMRRRRSSDPLGDT
ASNLGHAMDELMRQQPSLRGATIKAILQLLCELKCLGNDPNIICSRATSSKNEGGGSNAE
GTNASSNAPGENGSQADERSEDEVEEVEEVASTSKQSSSSVQMLTAAGGAKKNVPLLDYI
QNVTKFIQAIVSNNTGDHCTKFNETGGIAILLHLLRLPSLPLDFPTSAACQSITNLTQTV
FILLRAPTVVGESLAHVLDILKNELQPLFLTTPGETRTRPASVLLHELTQQQSADAAENE
GSSLVKSLVHLHAFVTLFLTLPRANQNEIRTIIVNQWGSRMGITALEGLNKLYRSLIWES
TVLLALCTPGAIPEDSEFGEKELENLLSSAEQGTSKTDSTEASVGMEMEGNEIKSAGSKH
KMSPAFSARIKCIKPVLTVASKLGRSLAELFGLLVKLAVGKPIRQRYGRHMAVAHAQNVA
PSRPARKLAYSLSTLLLDGLSWRAPPNVPSSKLRTTFLICTVGFTIPMLFDEKKMPYHLM
LQYFAGTGSLDALFNCFKWALSSQLDEDNSAEVSSQSNELPGSVDDFLEAWLMLLERLVN
PRNILNSPYVIHDKPAATTPTDELAPIVAPFSAVKFLIKTQKAALEALQHLWCSRRLSKL
SSRICDSVILILCHLIRGEQIARDKLNEEREEREKKAKANPPTAQDNSTNNRKNQTFQKD
LQQLVDMGFAREQVLQALMHASTLEAATEWLLTHSSEDDQLLRAISMSLEGTPAAAASEE
PETDAEEEVRDQEDKKKKEEEEQMKVEDEKDDEEPMSASDIDDFAASIFERGLELVNHLP
DTVYRVCDVIVVLMKRAGKNWSDGVFNKLVVQIKEKCQKLTDDYKSNGDGVWLQDDEFSD
GLAAQALLFALLYEEMKEPCTRVVSHNDLIPTFVALLSCASTWLQDHNDVSTTPKWISPV
LLLVDLYERTCITLARKSELQRRFEGHRREWKWFDDRSGRWCSYSASNHKSIDDAYAANL
PGIRFTAGRRRYTINFLQLIQFNEESGNRRPIMATYVKDSSLTDKDSNKKSKSEDADTLH
SSMRLLLSLKKNKNKKTPETMETDNNGKAAEPVPTSSEESFSGFIRLSPVDADKLVHSCT
AFVCLPVDADTLHSSMRLLLRLTRNGIEGGHLRALMFAELGGPAALLRLKFKHGFVGFAS
LATLLLRHILEEDATLKYSMDKAIHDITVSGAGNASCGVTSGSVGARELHYVLRALAPAA
CQHPDLFSEACKKNMKIVLPSLTSRNVETEEDNLVSSTGVQIISQSKRTQQAQPSLHLPP
VVVETLKLLLDALVATDDFGSEGRKTLIFTKKIKKFVFLAGADQRNSSTSVKLDASTSTS
KDNEELNLHQILQSEHSFGEKTQVKSEEGAKKSDHDPKASMEGDFKTQTGKPLVTKSAIL
RLLAELVKSYPSCAYLLANHQYKANMTPIVTQDCSCLSFILDNLLTPRTEEAVDKDCPAL
SRVLLACLAACQLQHPSGTSTLPGHDPHVALVSELKSAISRTVHTPESPQKHKRLRALLE
IVTTIIECTRTNPQQPRRTLARNQLPEPNVDQSQSVVPRLMVRRGLTTDLAKITHYIDLG
SSEMADTVNAALRPLEILTRYTSLYSNKAQQSENKKTTTEEETSQARSEQVQDRQASAEI
TSPQQWNTYTTADDGRLSFFYFYSDIVLLDGRQILVQQKLGVSDNMSDEYMDVLNPDNVS
QESDLHLAAEMQPGHRQDVFMREDEEEIAASRIEQDHDENDGAVDEDERVEDDIADDTIN
GDESTDSEQDEDDDDDDDDQDDEIEDDGSEMDNQEMDEDEVIEATEFGEDVDYETFVYDF
MHGDHQDMDLFIQMEDIFGISRSIPPPPGMIALCHPLLVRHANHAQITDSGGPISIPSNL
STAQQQQLINQQESNHTIHLHYTGGRQPRNAPLVLQRLLGPTVAQDILQVSNSLYTEGGG
RAQLIVNTDDANYTPTDIIDVIFLQSGVMANHSASLVPDNVPSSLARWVEESCVLDSQSL
YDCITVIKDEIVKHVLDVRDEELSERKEKRKKEKEEKQKEEEQKKKEREEKEKAKKQKKE
EVVENTPAEQVTTSSSPSIATPSNTPVATRPDSPSVSSKFIGNLKKLLNQAIFSKYVPKK
VNNTNFSNMPLLLSILSQEKDISTLFGFLKQNFFTTERAPAINALQQASSSLLAVSGQLE
GLSFSLQQAIGASEDVPATARSASDAQVSGETVSMVAEAAPFSADGATEQLAVPASDRGM
DNASPQSDVTMETYEAVAQSAANEMVVSEAEVVTTTTEEGATASSATAPSQVMEGVDPSF
LAALPADIRQEVIREQLSRSSHRTVAASSTTGQPSHSGVSPEFLAALPPNIQEEVLEQER
RERSRNTAQQAAAGENLDPTTFIQTLPPELRQSVLSDMDESLVAVLSEELAAEAQSLRDD
VDERQRRYLQERLLTHGVGLLRQGGVRSRSRHITEGFGGFQRRPGYTESTTRTGQTSTTT
TPPLVCRQILDHESLACLLLLLFVDETKLNTNWLHRVLRNLCYHVPSRDWLVATLMSILH
RASELHSPKPTTDSEMDVTPSQPTKLQKQMPKKSSISSSADTSFRNTSWMSIKLEAALGS
RSSIFQVEGGSSISPSPGSMKKHGRDQGSESSTKRVHIHPQASPVVCRHAIDALIVLSKI
FPNYFITQQPSKPKTGWGKSKSNGFPKCKTSPLQHRNKSSMIETDFWDILLRLDASSAHK
NLIKTFLDDPHVAGDSASEKSNIDLSITWLGVLMRMLSQPVVKRSQQLTDKMLRLLAQIS
RYITSEQSQKAKKDTPASGTAPNASVSNTGATTSAEVQVTSADQNSETSGTSTATMGARA
GTSNTSTVGRSTAAPQTSTTSSSRSQGSISTISETPATSGAKEDTALQLEKELSLTVGVL
TTHACSEEGLEDATTLLLHLSKSAPALRLLIIRLSLEGAQKLGGLLASQIKELLDEIIVY
NQQQLASGAIPAVTTAPTKGVIVNRFDSTLTVVLSAKDKFKKLGRELQLPSMQALTSKTS
HQAFFLRILKVIIQLQQASKEYQNFNDKSKKVTKFSSAGGSMLSAVQNTVSRLEREADAL
MDIISPPLPRYRNQTARASQSSSSAAASSSKSETEEEEKKDESTLSERLQLDELWEILGA
CLKELSKSHDQHAVLVLQPAVEAFFLVHSSETSQSSARRGGGGAETETRESQLAHINEQP
PVSPGQPTGSTSESSSSLSSQSSLIDASMPIDTQKFLKFADTHRTVLNQILRQSTVPLSD
GPFSVLVDHTRVLDFDVKRRYFRQELERTENSPIRRDDVAIRVQRDHLFEDSFRELHRRT
PAELRSRLYVVFDGEDGQDAGGVLREWYLVISREIFNPMYALFRTSPGDHGTYTINPLSY
INPNHLSYFKFVGRIVAKAIYDNKLLECYFTRSFYKHILGKPVKYTDMEADDYEFSQGLR
YLLEHDITSLGTELFFSVEIEEFGKTEVRDLKENGRNLPVSEKNKREYAHLVCQEKMTGA
IKKQLAAFLEGFYEIIPKRLISIFDEQELELLISGLPNVDIDDLRQNTEYHKYQPNSPQI
QWFWRALRSFDQAERAKFLQFVTGTSKVPLQGFSTLEGMTGVQKFQIHRDDRSTARLPCA
HTCFNQLDLPAYENYDKLRERLLLAITECTEGFGLA
Download sequence
Identical sequences F6XN27
ENSCINP00000024896 ENSCINP00000024896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]