SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000030253 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCINP00000030253
Domain Number - Region: 11-60
Classification Level Classification E-value
Superfamily WWE domain 0.00863
Family WWE domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000030253   Gene: ENSCING00000022773   Transcript: ENSCINT00000033494
Sequence length 75
Comment pep:known scaffold:KH:HT000119.1:103892:104747:1 gene:ENSCING00000022773 transcript:ENSCINT00000033494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKNNSRYNTPSTLNDRVLKNINSHYLTTYRYTCKLYLYNYNRTTKVNKTNQVVLHVRTFI
ICKLALPTLILKIFC
Download sequence
Identical sequences H2XKS1
ENSCINP00000030253 ENSCINP00000030253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]