SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000030272 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000030272
Domain Number 1 Region: 63-156
Classification Level Classification E-value
Superfamily WWE domain 2.88e-28
Family WWE domain 0.0000576
Further Details:      
 
Domain Number 2 Region: 3-51
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000194
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000030272   Gene: ENSCING00000019008   Transcript: ENSCINT00000035610
Sequence length 193
Comment pep:known scaffold:KH:HT000290.1:6276:9069:1 gene:ENSCING00000019008 transcript:ENSCINT00000035610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEIDCAICLQPCMQPVELPCSHVFCFLCAKGTALQSRRCALCRSEIPTSFISKPSKFT
KADQTDTPSSSNTNPKYVWFYQGYNGWWQYDERTCAEIEAAYLTEVKSVDLMIAGSVYVI
DFENKVQFQRNRNSRKRKIKRDIVSAPKKGVAGLSYEENSNNQPPACGNKDMASAMHLDV
NDEQSPDNEGQTK
Download sequence
Identical sequences A0A1W2W793
ENSCINP00000030272 ENSCINP00000030272 XP_002126121.1.78797 XP_002126148.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]