SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000030466 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000030466
Domain Number 1 Region: 95-153
Classification Level Classification E-value
Superfamily WWE domain 4.58e-17
Family WWE domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000030466   Gene: ENSCING00000022256   Transcript: ENSCINT00000033102
Sequence length 154
Comment pep:known chromosome:KH:1:6271547:6273689:1 gene:ENSCING00000022256 transcript:ENSCINT00000033102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIRTMCLLCSSCPNLAAQLVRNNIAETLRYLLCGTASDSDEIELVPRSPQELYEITSLI
GELMPRLPRDDPMFSVDRLLKQSGRGSGGETTATWQWRTDEGVWKSYSRHDNRMIEDSHR
NGDPEANLLVQGRVYVLDFNVMQQVNEDTGHARA
Download sequence
Identical sequences H2XLD4
ENSCINP00000030466 ENSCINP00000030466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]