SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000032623 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000032623
Domain Number 1 Region: 3-214
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.32e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000032623   Gene: ENSCING00000019541   Transcript: ENSCINT00000032665
Sequence length 217
Comment pep:known chromosome:KH:5:4499188:4500774:-1 gene:ENSCING00000019541 transcript:ENSCINT00000032665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKRVCVIGAGPAGLAATKSCLDNQLVPVCYELCSGLGGTWNNKERIRMKLSPKVYESL
ITNLSKEASAFSDFPMPKEWPPYQEWRQYLRYFELYADKFDLKRYIEFDVAVLEVHKSLS
YSQTGSWIVRSKSLINGNEKEIEFDAVIVASGGKTKQKWPEYSGLKDRFRGKVLHSGNYE
SAEEFKGKAVLICGAGNSGCDIAVNCSSVASNVLLST
Download sequence
Identical sequences H2XSI9
ENSCINP00000032623 ENSCINP00000032623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]