SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000001165 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000001165
Domain Number 1 Region: 483-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.35e-83
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 339-444
Classification Level Classification E-value
Superfamily SRCR-like 1.16e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00078
Further Details:      
 
Domain Number 3 Region: 21-125
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 214-295
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000902
Family Hairpin loop containing domain 0.039
Further Details:      
 
Domain Number 5 Region: 174-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 132-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 299-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000123
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000001165   Gene: ENSCING00000000636   Transcript: ENSCINT00000001165
Sequence length 741
Comment pep:known chromosome:KH:1:696141:701401:-1 gene:ENSCING00000000636 transcript:ENSCINT00000001165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRGKGSFTGDVRIDCRNKRGGCYKGGVQVFNREEGRWGNVCGAGWGKMDANVVCKYLKYK
KGAKKHLRLRKAKLSVVGKRLSPMLRNIRCTGGEAKLTECDGEAMRDGEGCEGERFAGVV
CQGKQTILEDDVTCSSSETRCANRKTCVTSQHVCDGTSDCPWGSDEENCGTTGVCDVDKF
WCGAGGGGCVSRSFVCDGDRDCVNGTDEIGCVQYLRQFTWLRNAKLQLTAGDYNSGWRHV
TPYTCAKKCREEKRFDCVSFDYHKDTKECDLTTHSSRNARLVRPREGNWDHYELKTPRRC
PGFRCVTSWSCIPASQQCDGEVQCRDGSDERNCSDVGGGFTIRLASGVSSYEGHLEVKRA
GEDFGLVCDIGWSMNEANVACRQLGFSRGALMALSGQFFQRSHRAYMLSDVTCRGDEVTI
DECRHSGWGVKDCPMDHEAGVVCICDVAIPTTTPTTTTTRGTTTAQRITTTATPRRTTAT
PPRCGVKPSTENHAIPRIVGGNFAQPNEWPWQVAIWLPWQFKCGGTLIDSCWVLTAAHCF
SQQYDVSNYWIRLGDHQSTVVDGTEQDFKIERIIKHNFNTNTNDNDIALIELKRHNGRCA
RLNEVVKLACLPTSLNQFPGGTKCHIVGWGQTSFESATPYTRLLKEATIPLISRRDCLAQ
SVYGTRLSTNMFCAGYIRGGVDTCQGDSGGPLLCQANDGLYYVWGVVSWGNGCAQPRSPG
VYTNVANYVGWITRNTGITFT
Download sequence
Identical sequences F6RQT3
ENSCINP00000001165 ENSCINP00000001165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]