SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000003701 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000003701
Domain Number 1 Region: 219-476
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-73
Family Nuclear receptor ligand-binding domain 0.0000000215
Further Details:      
 
Domain Number 2 Region: 166-248
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-30
Family Nuclear receptor 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000003701   Gene: ENSCING00000001836   Transcript: ENSCINT00000003701
Sequence length 507
Comment pep:known chromosome:KH:9:1526979:1533201:-1 gene:ENSCING00000001836 transcript:ENSCINT00000003701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPTTGNGLSSSQSSAPAMFTQSNQRVLQPPALSIMGFRGMPPMPHHPQFVMNSQGGMI
QLPHGLMVPGSEAPTVPTSNPAMASRFSADRLPVGGINGSISPQQIPDSSSGSQAGGNPM
SFGNITVKQEMGQGSMVPLQYPQLSSTENMGTNMFSVSSSGVPLSKHICAVCGDRASGKH
YGVYSCEGCKGFFKRTVRKYLTYTCRDDKDCIIDKRQRNRCQYCRYQKCITMGMKKEAVQ
EERQKNREQDECHGDGGHDDMPVDKILQAELASDPKMEELINMQEPIDTSVCKAADHQLF
TLVEWAKRVPMFGTLPLDDQVTLLRAGWNELLIASFSHRSIEIPDGIILASGLRVYRQSA
HSAGVGAIFDRVLTELIAKMRDMSMDRTELGCLRAIVLFNPDAKDLTDPAYIETLREKVY
ASLEVYCKSKYPDQAGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGNTPIDQFLMDKLAP
HDTEATSSPSTQATQNNDINLAGVANL
Download sequence
Identical sequences Q4H2U9
ENSCINP00000003701 NP_001071809.1.78797 ENSCINP00000003701 7719.ENSCINP00000003701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]