SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000004784 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000004784
Domain Number 1 Region: 44-130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-28
Family Nuclear receptor 0.0000799
Further Details:      
 
Domain Number 2 Region: 495-595
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-17
Family Nuclear receptor ligand-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000004784   Gene: ENSCING00000002352   Transcript: ENSCINT00000004784
Sequence length 597
Comment pep:known chromosome:KH:13:679925:690914:-1 gene:ENSCING00000002352 transcript:ENSCINT00000004784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSMLENIKAEPVVSVVEENSVSHFKQKKKPREKSSVSTVELLDMPCKVCGDKSSGVHYG
VYSCEGCKGFFRRTIHQKIKYRSCILDRTCSITKINRNRCQTCRFMKCLYVGMSKDAVKY
GRIPKKQKARLIAERLAEIRREKILEQTKESENGANENVSGNETPTRRESTESDVFRKTP
PKNMSVNESMLYDALHNSESTGVDSYIQESFPKSPTIRQPPELIPKCAFLSNGARNTLNG
YQENFQDQREKSKQRAYYESKQRAYSDQTFLSSSNPVKPRSSSDSSMSHSPSNPPPLLLL
GRSFPGANGETSPNEIKKTDNYKSPNGRSADSTRKFPIFNFDKTTEKYRKSAPQSLFFSK
SIDSKPTHRRNPSTPTTDLTPVPKFIPTPFSEPRRKFPPTYQVYIPPPIYSSSHCLTSKP
HIITQPVDTISSPTRIDFNPKPATQFRTPSNTMHIALDYSSRTRSSSSPDSGCPEANDCE
METQRTTGITGNGNTAQIPLPELVDLIVRAHNETSHASRHALFLTKMDHRVAHKGTYTAT
DDDQIDWASFNACFEPAVREVVEFAKTIPGFDKLCQEDKVLLLKTASLEILLVRMTS
Download sequence
Identical sequences F6PJI0
ENSCINP00000004784 ENSCINP00000004784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]