SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000012890 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000012890
Domain Number 1 Region: 252-449
Classification Level Classification E-value
Superfamily Nudix 2.03e-41
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 20-99
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-17
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000012890   Gene: ENSCING00000006248   Transcript: ENSCINT00000012890
Sequence length 454
Comment pep:known chromosome:KH:5:1197791:1201699:1 gene:ENSCING00000006248 transcript:ENSCINT00000012890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSGNSNAQKYYIDEIFTAAANGDVEAITKGYNMLSISPDVTDKMGWTPLMCAARNGHVN
VMGFLLQQGADPKHMNKSGQTALDVASFWNQTGSVNFLNGFLKPNKSPVMEVVHYFGFSA
LDRQSYQRSDENEMKKAMRMENAKYVVFADLQLLVSNDAVTGKSQNVVYLTWGEIEKYLS
IVDHDLIFLGVGNIDKGLLVRETHHAQLNDSPYFAVNFKKVSRDDEFSPEKYNGSFTDKD
NRRLMMMLQKNESGLVAQARSVLAWHERYNFCPTCGNETIMKDFGYKRLCISESCTTHKG
AHNTSFPRTDPVVIILVASKDGSKCLLGRQSRFPRGMYSCIAGFMEPGESIEDAARREVF
EESGVKVGQVEYHSSQPWPFPSNIMIGLIGRAVCDDINVDKVELEDARWFDKPEVAKAIL
EGFGRKEGLVVPPHTAIAHHLIKTWVQRNSNSNL
Download sequence
Identical sequences F6XNV2
ENSCINP00000012890 ENSCINP00000012890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]