SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000014259 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000014259
Domain Number 1 Region: 368-634
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-67
Family Nuclear receptor ligand-binding domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 295-376
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.48e-31
Family Nuclear receptor 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000014259   Gene: ENSCING00000006945   Transcript: ENSCINT00000014259
Sequence length 638
Comment pep:known chromosome:KH:9:3628765:3650128:1 gene:ENSCING00000006945 transcript:ENSCINT00000014259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVESVDSSVDSRSHMESSQTLQRKSSIDSQATTAESLGSPSPRILLSPSPQPLPFFPH
YTAQFYGLGTSESPKHFKSASSASNMSSHPSVSASQSDYHKQFMSQALSMAMMPPSFPPS
YGIGGYNSAVDIQGFLISAAAQAMSAALKPHALNSNSPPSAQSSWKLPPTSCTASPVGNY
LHKSHTSSGRGADRLNEVDCMPNPSHFNGTANHGQENAKRRKMSEMRDGGRERNPIESSV
SPTSVGLNNHTGEKCRASPDSVGLSSTGSSYSGSESDGLHPGQCPPSPPPPPRIYKPCFV
CGDKSSGYHYGVASCEGCKGFFRRSVQKNMQYTCHRNKQCLINKSTRSRCQYCRLQKCIQ
AGMLRESVRNDRNKKRGKEKEGKSDQNGVDEPSCSPEIEALVTSVHKFHVETFPLSSELK
KYQIPSPPIVKDTSAKTDSNLWEKFAELSTKCIVKIVEFAKGIPGFQDFTIADQITLLKC
ACLEVLFLRICSRFSPEHDTMTFSDGLTLTRKQMRVCGFGPITEQVFSFAQSLHPLNADA
TEIGLLSAICLVSADRVDLEEPDKVELLQESLVEGLKYYARKRRPHTPQVFPKLIIKISD
LRSISLKGADRVVTVKTEIPCGAMPPLMSEMLENDEVE
Download sequence
Identical sequences F6VND6
ENSCINP00000014259 7719.ENSCINP00000014259 ENSCINP00000014259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]