SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000014778 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000014778
Domain Number 1 Region: 339-556
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-67
Family Nuclear receptor ligand-binding domain 0.000000344
Further Details:      
 
Domain Number 2 Region: 207-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000014778   Gene: ENSCING00000007203   Transcript: ENSCINT00000014778
Sequence length 557
Comment pep:known chromosome:KH:2:6562310:6567961:-1 gene:ENSCING00000007203 transcript:ENSCINT00000014778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYSIPPSPQNLQNPQTPQNPQEIPQYQPIPTQPFITKLDQGNPQVSTQGTQPSPSVAIND
PHISSSVQDSGLNPVILQELQRLQALASTSSSYSATDIAKILRTISDIASNPKKEAESPS
TSMTQQIPTNPISGPSTPQENKLPPSPANTFITSTIFTEALSPGSQSRSSSVSSIPDPNI
QHIQKVPEAPVREKRKKGPAPKLDGNEVCLICGDKASGYHYGVLSCEGCKGFFRRCIIKT
PNFKCKNNGQCQMDTYMRRKCQKCRLDKCRAAGMKDETVLTEVQSKAKRMKREKDNSTFV
ASPHHFAPNLSFNGEPIPSLTSHQRNLVEMLQANEARFQWPTQEAVAKVTPWVESGDSHR
CRASRFAHFTELAILIVQLVVEFTKQLPGFLTVSREDQILLLKACTIEVMLLRAAKQYDK
KSKAINFLNGKFYDKSSFYRAGMQVEFVDPIFDFCNSMAQLGLNEAEYALLVAINTFSAD
RPNIKDMHKVEAVQNSYVELLRVYLKIHHPSDPLMFPRTLMKLVELRTLNNYHSEQIFAL
KVQDKQLPPLLAEIWDM
Download sequence
Identical sequences F6Y836
ENSCINP00000014778 ENSCINP00000014778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]