SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000016440 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000016440
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 161-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000016440
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0351
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000016440   Gene: ENSCING00000008036   Transcript: ENSCINT00000016440
Sequence length 490
Comment pep:known scaffold:KH:HT000098.1:796242:801991:1 gene:ENSCING00000008036 transcript:ENSCINT00000016440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DINECELIVDLCNGNSSCINTLGSYICLCPPGFTLQGNSSDPCQDVDECYPEEEEKQCGF
NAYCVNNPGSYTCICESGYLGDGQYTCECKLGFIGDGINCYGSGNYCEDVDECKVFDFCH
MYATCENHQGSFSCNCKPGFAGNGYVCQALYFSTIFRNNADIDECLNNMSNCLRDGTSSC
SNTIGSYFCACADGFRGDGITTCTKVNKPNDCLLGTHDCDKQATCSFSGNEFTCTCNQIN
KNVILFSVSPVMVQCTTTSITVKVIADYYMQKSIRLPDLHLNDFECGGQQTALSDEYWDF
IIDDLSSCGTIVSKNQTHITYSNILSNSVKSGVYMGTLVSVPFSCSYPSNLTVALPTPYY
PEANVISIAGPNGTGTFVVEMNIYTDSSYSFISNTTSFATTDILYVQTTLTADDNSLALL
IHDCWATPTSSGVDPNAYYFIDNGCPIPGRVADTVHITMNGVSKISRFHTQVFGFVDYNT
TYFHCTVDLC
Download sequence
Identical sequences F6S5F0
ENSCINP00000016440 ENSCINP00000016440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]