SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000019457 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000019457
Domain Number 1 Region: 199-425
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-62
Family Nuclear receptor ligand-binding domain 0.0000000297
Further Details:      
 
Domain Number 2 Region: 106-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000019457   Gene: ENSCING00000009566   Transcript: ENSCINT00000019457
Sequence length 512
Comment pep:known chromosome:KH:3:2599713:2613073:1 gene:ENSCING00000009566 transcript:ENSCINT00000019457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDADMHSNYGLDAVNPDQLYQDMIPSLQDSPTSLHGNGPDIGAFTYGMPHPMSPAHPMN
PSPTADVPIHPISPESVGMPGGLINGHGSDHESNTSMVGEGDGVRTFCAICGDRATGKHY
GASSCDGCKGFFRRSVRKNHQYQCRFSRNCTVDKDKRNQCRYCRLRKCFRAGMKREAVQN
ERDRISTKKSTIDDSASLSVTTLLNADTMSKQPSAGSAGDVTDTVSIENKKIASVNDVCD
SIRQQLLVLVEWAKYIPAFSELPLDDQVALLRAHAGENLLMGAAKRSLPYKDVLLLGNDF
IIPRHCPEVEITRVAVRVLDELVRPLADLSLDANEFACLKAIVFFDPDARGLNNPTKIKQ
MRSQVMCNLEDYINDRQYDSRGRFGEILLLLPTLQSITWQMIEQIQFVRIFGVARVDNLL
QEMLLGSANEAQASMIPASAAQCGAMGPGSPTHISLANGMVPCSPGLMTMGEKPPNMSPT
TPISPSMPQNMGQPIGMEIDSHVLLQPKSEIL
Download sequence
Identical sequences Q4H3D5
ENSCINP00000019457 ENSCINP00000019456 7719.ENSCINP00000019455 NP_001071735.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]