SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000019806 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000019806
Domain Number 1 Region: 443-533
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 6.41e-35
Family Small-conductance potassium channel 0.00000792
Further Details:      
 
Domain Number 2 Region: 312-479
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.06e-24
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000019806   Gene: ENSCING00000009747   Transcript: ENSCINT00000019806
Sequence length 582
Comment pep:known scaffold:KH:HT000174.1:231793:245344:1 gene:ENSCING00000009747 transcript:ENSCINT00000019806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSAPFGNSREELHIPTKKQDQQLKKEHLSSSLTALSTPRSPEKHTWDYGSSKPNPFAEIA
MKSAKHNGVVSAFPKLGASTRSLNRLEHNFYDEDGECIPLTQVSPQATHTESYLAPPDLV
GGHKNDSDHPGKKVDGSDTAQVDSSSMQMDKKSLGANNNKTMNIGYRLGYRRTLFERRKR
LSDYALIFGMFGIIVMVIETELSSGNIADLATYFSLALKCLISLSTALLLGLVVAYHARE
IQLFMIDNGAEDWRIAMDWERVMFITLELTICSIHPIPGLYTFEWSARHAFSGVTTTTTA
DVDILLSIPMFLRLYLIARVMLLHSRLFTDASSRSIGALNKINFNTRFVMKTLMTICPGT
VLLVFSISLWIIAAWTIRACERYHDTENVNSNFLSSMWLISITFLSIGYGDLVPNTFCGR
TVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRTWLI
YKSTKLTDKLDSTKVRRHQRKFLHAIYQLRNFKMEQRKLNDQANTLIDFAKMQIRVSDML
SEITTRHETVEDRVCQIGTRLENLEQQVSKLPELLAEVVQTQ
Download sequence
Identical sequences F7ACB9
ENSCINP00000019806 ENSCINP00000019806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]