SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000024306 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000024306
Domain Number 1 Region: 441-640
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-55
Family Nuclear receptor ligand-binding domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 46-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-27
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000024306   Gene: ENSCING00000013188   Transcript: ENSCINT00000024552
Sequence length 644
Comment pep:known chromosome:KH:8:4369917:4389680:-1 gene:ENSCING00000013188 transcript:ENSCINT00000024552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKCDKVDADVSPDCVKTECPKVLAPLRKKRPSTKLLVKSTDLNILCKVCGDKASGFH
YGVHACEGCKGFFRRTIRLKIEYETCVQSCKVDLKSRNKCQFCRFKKCVGLGMSRDAIRF
GRMPRHEKQQIIQEIEKKSNKTGSTSGNVLGYQKLITEISESFLQHISLTQERVNACWES
RKALGDKAKTLHTFHDIPACFPNLSTYYAQFKSFTTQDDGKPMAPEMTLSDHLKSFLNST
NRNKSNVSNNGQSKPVMEPAPDIQSSELTSSSPTDQLNSRPSTSSTPSLSSQQHSFELKG
ILDFISMPPNSSSQRDPFHGTMQNSTANGSLNKPSKCDDKLEKEPRLKETPTNASTAFQT
MKNLSNIKTFQSMYETICSPSGESFKLLLEQNPGFLEGMDPTKLVSPCDEMLTPDLKARL
LFASQVFKKNIGKDKPTIYKNVIGSKIVQILYSDFQARVVNGICELTEFAKRLPNFHDIS
LQDQVILLKYGSYETMFVLFSRLIYGEGMILPKSNIYVTFNFVYQLGVAGDIMKSKFLFA
KKMLALELTDDEMALFVAMIILCPDRPEINDRKLVERIQEKVLFALEYQLSISHPHKPRL
FAHLLLKMAELRELVSKHVVMVQKLADAKDFVPPLLCEIMQDMK
Download sequence
Identical sequences Q4H2X6
7719.ENSCINP00000024308 NP_001071801.1.78797 XP_018668265.1.78797 ENSCINP00000024306 ENSCINP00000024308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]