SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000031213 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000031213
Domain Number 1 Region: 164-367
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-45
Family Nuclear receptor ligand-binding domain 0.0000272
Further Details:      
 
Domain Number 2 Region: 43-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.25e-27
Family Nuclear receptor 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000031213   Gene: ENSCING00000021968   Transcript: ENSCINT00000035854
Sequence length 587
Comment pep:known chromosome:KH:11:4238199:4243388:1 gene:ENSCING00000021968 transcript:ENSCINT00000035854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNQIIPNSIDCFPRHAMGRGNKDKRKNMKGYIPSYLDGNEECVVCGDKATGYHYRCIT
CEGCKGFFRRTVQKDLQKTYQCKQRGKCQVNKVSRNQCQMCRYEKCIATGMATDLVLNED
KRIAKRKLIERNRQLRRHKDISHVMGTWKVGRVSDDDNHVIAAVVQAHYDVINDDDIEET
SRSPTHGEQFSSALTNAVTRVVEFAKRLPFFTEKVSTDDQVAMLKGCCMEVIVLNCVASY
DRARCTLKLFSKVIITREKLRRTRFDHFADDLFRTAEEMSILQLTETEIAMLKAIIVFAA
DRPRIQHIDEIRNIQDSLLQSLRYYVMDKRQHEYAVWSTLLIKMADIRRISNGFAASLMD
MKLNNPEELIVLFAEDRRGTPDDHTPLQDARMDTTKTSASQKLCQKGGNKENRMDNSKRV
STSVKKVSNSWPPTYKRDEPFMSNRALLPQHYGVWSCFPKPSYDLPNPSLPKPSGFQPLQ
LPHAALSGHVGKTLGRNNFILPTALHPSLNTVKHSDMFRAMPVDSGEFIPSINPPAYIAN
SKTNVSPQTRWLLKERFTQEKGTHISDKNVHANQNATEEAINLSLKL
Download sequence
Identical sequences H2XNI0
ENSCINP00000031213 XP_009860198.1.78797 ENSCINP00000031213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]