SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000032172 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000032172
Domain Number 1 Region: 315-401
Classification Level Classification E-value
Superfamily RING/U-box 7.06e-16
Family RING finger domain, C3HC4 0.0014
Further Details:      
 
Domain Number 2 Region: 56-161
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000903
Family WWE domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCINP00000032172
Domain Number - Region: 9-72
Classification Level Classification E-value
Superfamily WWE domain 0.00288
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000032172   Gene: ENSCING00000021601   Transcript: ENSCINT00000033045
Sequence length 525
Comment pep:known chromosome:KH:11:4970000:4973097:-1 gene:ENSCING00000021601 transcript:ENSCINT00000033045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRDNIAIWEYLDEFWKMFSVKMCQNIEDGYQNYRQGSSANRLKLPRGSIDFKTMEYSSQ
QLIGPGTIRRVVLPGSSLLARNHTWQWKYKNAWENYTAEVNQLIEDHANWNKHQPLNLSQ
YDPTLMYIIYINDQKSGVQQNKNTGYQRKIRKERFSFKFPTTTDKVTSSLSNPATNSYTT
TPTHQQASSARQRRTASRNTHHSSQSSQHYYSNTPLYTIQPATAPSASYTTNSHHSSQSS
QHHYSNTLSYTTQPGTTPSYTTNSHHSNPRATSFQNIFSTDPYSSTTNTPALNAINSSSG
GKQGLLDKFSTTLTTPPSDDCVICMTSLSDVSGFQTSGATNQASSVIELKTCKHIFHAEC
LIASMQSGANDSFTCPCCKVIYGVKTGNQPPGQMHWSVIQTSVPGYEPHHTIRITYDIRA
GMQTNEHPNPGRRYSVHGFPRIAYLPDNTDGNKVLRLLEVAWNRKLIFTVGDSVTSGAKD
TVTWNEIHHKTSITNKHGHGYPDPNYLTNVLNELKAQGVSEDDLK
Download sequence
Identical sequences H2XSL2
ENSCINP00000032646 ENSCINP00000032172 XP_009860193.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]